PMID: PMC4261947-1-2

 

    Legend: Gene, Sites

Title : QuantitativeAnalyses of Glycopeptides from PSA and PSA-HighpI Isoform

Abstract :

1. The quantitation of all identified glycopeptidesassociated with the three detected peptide backbones is summarizedin Tables 1 and 2
2. Averagepeak areas and standard deviation values ( STD ) were measured fromtechnical triplicates
3. Figure 4 showsthe quantitation results of N-glycans on the NKSVILLGR backbone
4. Thereare 66 common N-glycans with 68 total identified glycoforms that werequantitatively compared between PSA and PSAH samples
5. The abundancesof two glycopeptides associated with the peptides AVCGGVLVHPQWVLTAAHCIRNKand AVCGGVLVHPQWVLTAAHCIRNKSVILLGR were excludedbecause their ionization efficiencies might be different from thoseof other glycopeptides associated with the peptide NKSVILLGR
6. Figure 4B depicts a separate comparison of two glycoformsthat demonstrated a higher abundance for PSAH relative to that inall other structures
7. The most abundant glycoform for PSA was determinedto be HexNAc3Hex4dHex1NeuAc1 (13.3%)
8. Four glycopeptides possessingdifferent glycan structures, namely, HexNAc3Hex6NeuAc1 (9.3%), HexNAc4Hex4NeuAc1(7 .9%), HexNAc4Hex4dHex1NeuAc1 (6.8%), and HexNAc5Hex5NeuAc1(5 .7%) were detected as the next most abundant ions
9. On the otherhand, glycopeptides with HexNAc4Hex5dHex1NeuAc1 (28.9%) andHexNAc4Hex5dHex1NeuAc2 (27%) were observed at higher intensitiesin the PSAH sample
10. Glycopeptides possessing HexNAc5Hex5NeuAc1(6 .8%), HexNAc5Hex4dHex1NeuAc2 (6.6%), HexNAc5Hex5NeuAc2(5 .3%), and HexNAc5Hex4dHex1NeuAc1 (5.2%) glycans were observedas the next most abundant ions
11. The glycoform of HexNAc5Hex4dHex1s/pwas identified in both PSA and PSAH with different abundances (0.52and 0.28%, respectively)
12. An interesting observation related to thisstructure is that the summation of the relative abundances of HexNAc5Hex4dHex1and HexNAc5Hex4dHex1s/p from PSAH was determined to be comparablewith the intensity of HexNAc5Hex4dHex1s/p from PSA
13. On the other hand,HexNAc5Hex4dHex1 was not detected for PSA
14. The abundances of the 46 commonN-glycans were compared betweenthe PSA and PSAH samples
15. For example, the glycopeptides possessingHexNAc3Hex6NeuAc1 (>21.7-fold), HexNAc4Hex4NeuAc1 (>13.8-fold),HexNAc4Hex3dHex1NeuAc1(>8-fold), HexNAc3Hex4dHex1NeuAc1 (>6.5-fold), and HexNAc5Hex4NeuAc1(>5-fold) were detected with higher intensities in the PSA samplecompared with that of the PSAH sample
16. On the other hand, the glycopeptideswith HexNAc5Hex4dHex1NeuAc2 (>9.2-fold), HexNAc4Hex5dHex1NeuAc2(>4 .8-fold), and HexNAc4Hex5dHex1NeuAc1 (>3.2-fold) wereobservedwith higher abundances in PSAH than that in PSA

Output (sent_index, trigger, protein, sugar, site):

• 11. glycoform, , -, HexNAc5Hex4dHex1s/pwas, -
• 15. detected, , PSA, HexNAc3Hex4dHex1NeuAc1, -
• 15. detected, , PSA, HexNAc4Hex3dHex1NeuAc1, -
• 15. detected, , PSA, HexNAc4Hex4NeuAc1, -
• 15. detected, , PSA, HexNAc5Hex4NeuAc1, -
• 15. detected, , PSA, possessingHexNAc3Hex6NeuAc1, -
• 15. glycopeptides, , -, -, glycopeptides
• 5. glycopeptides, , -, -, glycopeptides
• 8. glycopeptides, , -, HexNAc3Hex6NeuAc1, glycopeptides
• 8. glycopeptides, , -, HexNAc4Hex4NeuAc1, glycopeptides
• 8. glycopeptides, , -, HexNAc4Hex4dHex1NeuAc1, glycopeptides
• 8. glycopeptides, , -, HexNAc5Hex5NeuAc1, glycopeptides
• 9. glycopeptides, , -, HexNAc4Hex5dHex1NeuAc1 (28.9%) andHexNAc4Hex5dHex1NeuAc2, glycopeptides

Output(Part-Of) (sent_index, protein, site):

• 15. PSA, glycopeptides
• 9. intensitiesin, glycopeptides

*Output_Site_Fusion* (sent_index, protein, sugar, site):

 

Protein	NCBI ID	SENTENCE INDEX